Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since over 7 years ago

Intermediate Pilot

Summary

Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126
  1. Avatar for lconor 81. lconor Lv 1 1 pt. 10,358
  2. Avatar for cherry39 82. cherry39 Lv 1 1 pt. 10,353
  3. Avatar for parsnip 83. parsnip Lv 1 1 pt. 10,335
  4. Avatar for jebbiek 84. jebbiek Lv 1 1 pt. 10,335
  5. Avatar for dbuske 85. dbuske Lv 1 1 pt. 10,325
  6. Avatar for gstelle 86. gstelle Lv 1 1 pt. 10,291
  7. Avatar for lamoille 87. lamoille Lv 1 1 pt. 10,276
  8. Avatar for DipsyDoodle2016 88. DipsyDoodle2016 Lv 1 1 pt. 10,273
  9. Avatar for martinf 89. martinf Lv 1 1 pt. 10,259
  10. Avatar for cbwest 90. cbwest Lv 1 1 pt. 10,231

Comments