Placeholder image of a protein
Icon representing a puzzle

1545: Sketchbook Puzzle - Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
July 09, 2018
Expires
Max points
100
Description

This protein has 92 residues! It was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Beta Folders 100 pts. 11,660
  2. Avatar for Void Crushers 2. Void Crushers 70 pts. 11,652
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,621
  4. Avatar for Go Science 4. Go Science 30 pts. 11,619
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,619
  6. Avatar for Contenders 6. Contenders 11 pts. 11,527
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,510
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,435
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 11,230
  10. Avatar for Minions of TWIS 10. Minions of TWIS 1 pt. 11,126

  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 1 pt. 9,674
  2. Avatar for wozzarelli 112. wozzarelli Lv 1 1 pt. 9,657
  3. Avatar for LeoStar 113. LeoStar Lv 1 1 pt. 9,485
  4. Avatar for yoyoparis 114. yoyoparis Lv 1 1 pt. 9,477
  5. Avatar for davima14 115. davima14 Lv 1 1 pt. 9,187
  6. Avatar for Gahmeir 116. Gahmeir Lv 1 1 pt. 8,952
  7. Avatar for StinkingBishop 117. StinkingBishop Lv 1 1 pt. 8,837
  8. Avatar for beta_helix 118. beta_helix Lv 1 1 pt. 8,822
  9. Avatar for 01010011111 119. 01010011111 Lv 1 1 pt. 7,279
  10. Avatar for Jane Jiang 120. Jane Jiang Lv 1 1 pt. 6,003

Comments