Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups



  1. Avatar for alwen 91. alwen Lv 1 1 pt. 8,674
  2. Avatar for tyler0911 92. tyler0911 Lv 1 1 pt. 8,651
  3. Avatar for ivalnic 93. ivalnic Lv 1 1 pt. 8,635
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 1 pt. 8,609
  5. Avatar for doctaven 95. doctaven Lv 1 1 pt. 8,603
  6. Avatar for diamonddays 97. diamonddays Lv 1 1 pt. 8,577
  7. Avatar for Richard Huang 98. Richard Huang Lv 1 1 pt. 8,471
  8. Avatar for MilkyBoat 99. MilkyBoat Lv 1 1 pt. 8,458
  9. Avatar for Tehnologik1 100. Tehnologik1 Lv 1 1 pt. 7,876

Comments