Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups



  1. Avatar for toshiue 101. toshiue Lv 1 1 pt. 7,851
  2. Avatar for shahrez 102. shahrez Lv 1 1 pt. 7,815
  3. Avatar for 01010011111 103. 01010011111 Lv 1 1 pt. 6,842
  4. Avatar for Hollinas 105. Hollinas Lv 1 1 pt. 1,432
  5. Avatar for phi16 106. phi16 Lv 1 1 pt. 1,432
  6. Avatar for antibot215 107. antibot215 Lv 1 1 pt. 1,432
  7. Avatar for JellyJump 108. JellyJump Lv 1 1 pt. 1,432
  8. Avatar for ReallyRatherDumb 109. ReallyRatherDumb Lv 1 1 pt. 1,432
  9. Avatar for ed357753 110. ed357753 Lv 1 1 pt. 1,432

Comments