Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Stuyvesant Molecular Science 2017-18 11. Stuyvesant Molecular Science 2017-18 1 pt. 8,840
  2. Avatar for Team South Africa 12. Team South Africa 1 pt. 8,603
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 11 pts. 9,833
  2. Avatar for alcor29 42. alcor29 Lv 1 10 pts. 9,826
  3. Avatar for ManVsYard 43. ManVsYard Lv 1 9 pts. 9,801
  4. Avatar for silent gene 44. silent gene Lv 1 9 pts. 9,618
  5. Avatar for johnmitch 45. johnmitch Lv 1 8 pts. 9,610
  6. Avatar for frostschutz 46. frostschutz Lv 1 7 pts. 9,567
  7. Avatar for rabamino12358 47. rabamino12358 Lv 1 7 pts. 9,548
  8. Avatar for joaniegirl 48. joaniegirl Lv 1 6 pts. 9,502
  9. Avatar for eusair 49. eusair Lv 1 6 pts. 9,490
  10. Avatar for PMiglionico 50. PMiglionico Lv 1 6 pts. 9,473

Comments