Placeholder image of a protein
Icon representing a puzzle

1549: Sketchbook Puzzle - Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 16, 2018
Expires
Max points
100
Description

This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 1542b. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. In this experimental puzzle you will have 256 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups



  1. Avatar for cbwest 61. cbwest Lv 1 2 pts. 9,266
  2. Avatar for JasperD 62. JasperD Lv 1 2 pts. 9,262
  3. Avatar for LavenderSky 63. LavenderSky Lv 1 2 pts. 9,202
  4. Avatar for katling 64. katling Lv 1 2 pts. 9,188
  5. Avatar for alyssajoyh 65. alyssajoyh Lv 1 2 pts. 9,167
  6. Avatar for atlas100 66. atlas100 Lv 1 2 pts. 9,128
  7. Avatar for ourtown 67. ourtown Lv 1 1 pt. 9,105
  8. Avatar for kludbrook 68. kludbrook Lv 1 1 pt. 9,100
  9. Avatar for Arne Heessels 69. Arne Heessels Lv 1 1 pt. 9,096
  10. Avatar for rinze 70. rinze Lv 1 1 pt. 9,079

Comments