Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,627
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,513
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,502
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 10,395
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,294
  6. Avatar for Contenders 6. Contenders 7 pts. 10,196
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 10,145
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,970
  9. Avatar for freefolder 9. freefolder 1 pt. 9,823
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,762
  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,627
  2. Avatar for bertro 2. bertro Lv 1 96 pts. 10,505
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 92 pts. 10,502
  4. Avatar for tyler0911 4. tyler0911 Lv 1 88 pts. 10,486
  5. Avatar for reefyrob 5. reefyrob Lv 1 84 pts. 10,476
  6. Avatar for robgee 6. robgee Lv 1 80 pts. 10,457
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 76 pts. 10,395
  8. Avatar for pvc78 8. pvc78 Lv 1 72 pts. 10,312
  9. Avatar for frood66 9. frood66 Lv 1 69 pts. 10,294
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 66 pts. 10,262

Comments