Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for sciencewalker
    1. sciencewalker Lv 1
    100 pts. 10,597
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 76 pts. 10,595
  3. Avatar for Hollinas 3. Hollinas Lv 1 56 pts. 10,592
  4. Avatar for mirp 4. mirp Lv 1 41 pts. 10,592
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 29 pts. 10,592
  6. Avatar for toshiue 6. toshiue Lv 1 20 pts. 10,552
  7. Avatar for reefyrob 7. reefyrob Lv 1 14 pts. 10,513
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 9 pts. 10,509
  9. Avatar for LociOiling 9. LociOiling Lv 1 6 pts. 10,504
  10. Avatar for Galaxie 10. Galaxie Lv 1 4 pts. 10,502

Comments