Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for shahrez 101. shahrez Lv 1 1 pt. 8,568
  2. Avatar for Might-o-chondria 102. Might-o-chondria Lv 1 1 pt. 8,004
  3. Avatar for gask09 103. gask09 Lv 1 1 pt. 6,992
  4. Avatar for 01010011111 105. 01010011111 Lv 1 1 pt. 6,394
  5. Avatar for Dawit 106. Dawit Lv 1 1 pt. 4,858
  6. Avatar for DOCnames 107. DOCnames Lv 1 1 pt. 4,858
  7. Avatar for ReallyRatherDumb 108. ReallyRatherDumb Lv 1 1 pt. 4,858
  8. Avatar for frostschutz 109. frostschutz Lv 1 1 pt. 4,858
  9. Avatar for Amsterdamaged 110. Amsterdamaged Lv 1 1 pt. 4,858

Comments