Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 63 pts. 10,262
  2. Avatar for Crossed Sticks 12. Crossed Sticks Lv 1 60 pts. 10,215
  3. Avatar for LociOiling 13. LociOiling Lv 1 57 pts. 10,208
  4. Avatar for mirp 14. mirp Lv 1 54 pts. 10,172
  5. Avatar for Galaxie 15. Galaxie Lv 1 51 pts. 10,171
  6. Avatar for Idiotboy 16. Idiotboy Lv 1 49 pts. 10,168
  7. Avatar for O Seki To 17. O Seki To Lv 1 46 pts. 10,145
  8. Avatar for crpainter 18. crpainter Lv 1 44 pts. 10,145
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 41 pts. 10,139
  10. Avatar for Glen B 20. Glen B Lv 1 39 pts. 10,120

Comments