Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for hpaege 21. hpaege Lv 1 37 pts. 10,067
  2. Avatar for silent gene 22. silent gene Lv 1 35 pts. 10,042
  3. Avatar for johnmitch 23. johnmitch Lv 1 33 pts. 10,034
  4. Avatar for diamonddays 24. diamonddays Lv 1 31 pts. 10,033
  5. Avatar for Threeoak 25. Threeoak Lv 1 30 pts. 10,029
  6. Avatar for cbwest 26. cbwest Lv 1 28 pts. 10,023
  7. Avatar for Deleted player 27. Deleted player pts. 10,023
  8. Avatar for Merf 28. Merf Lv 1 25 pts. 10,013
  9. Avatar for sciencewalker 29. sciencewalker Lv 1 24 pts. 10,002
  10. Avatar for SouperGenious 30. SouperGenious Lv 1 22 pts. 9,998

Comments