Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for leehaggis 31. leehaggis Lv 1 21 pts. 9,996
  2. Avatar for stomjoh 32. stomjoh Lv 1 20 pts. 9,982
  3. Avatar for Mike Cassidy 33. Mike Cassidy Lv 1 18 pts. 9,971
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 17 pts. 9,970
  5. Avatar for jausmh 35. jausmh Lv 1 16 pts. 9,968
  6. Avatar for guineapig 36. guineapig Lv 1 15 pts. 9,967
  7. Avatar for justjustin 37. justjustin Lv 1 14 pts. 9,952
  8. Avatar for YeshuaLives 38. YeshuaLives Lv 1 13 pts. 9,952
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 13 pts. 9,942
  10. Avatar for georg137 40. georg137 Lv 1 12 pts. 9,916

Comments