Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for nicobul 41. nicobul Lv 1 11 pts. 9,904
  2. Avatar for joaniegirl 42. joaniegirl Lv 1 10 pts. 9,890
  3. Avatar for veroxdraco 43. veroxdraco Lv 1 10 pts. 9,861
  4. Avatar for LavenderSky 44. LavenderSky Lv 1 9 pts. 9,858
  5. Avatar for NinjaGreg 45. NinjaGreg Lv 1 8 pts. 9,850
  6. Avatar for dcrwheeler 46. dcrwheeler Lv 1 8 pts. 9,846
  7. Avatar for Flagg65a 47. Flagg65a Lv 1 7 pts. 9,836
  8. Avatar for jobo0502 48. jobo0502 Lv 1 7 pts. 9,836
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 6 pts. 9,830
  10. Avatar for Altercomp 50. Altercomp Lv 1 6 pts. 9,823

Comments