Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,622
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,448
  3. Avatar for Stuyvesant Molecular Science 2017-18 13. Stuyvesant Molecular Science 2017-18 1 pt. 8,004
  1. Avatar for drjr 51. drjr Lv 1 5 pts. 9,812
  2. Avatar for MicElephant 52. MicElephant Lv 1 5 pts. 9,801
  3. Avatar for alcor29 53. alcor29 Lv 1 5 pts. 9,788
  4. Avatar for alwen 54. alwen Lv 1 4 pts. 9,768
  5. Avatar for Blipperman 55. Blipperman Lv 1 4 pts. 9,762
  6. Avatar for alyssajoyh 56. alyssajoyh Lv 1 4 pts. 9,756
  7. Avatar for ViJay7019 57. ViJay7019 Lv 1 3 pts. 9,739
  8. Avatar for mitarcher 58. mitarcher Lv 1 3 pts. 9,726
  9. Avatar for Deleted player 59. Deleted player pts. 9,717
  10. Avatar for isaksson 60. isaksson Lv 1 3 pts. 9,694

Comments