Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 2 pts. 9,692
  2. Avatar for kludbrook 62. kludbrook Lv 1 2 pts. 9,690
  3. Avatar for rezaefar 63. rezaefar Lv 1 2 pts. 9,656
  4. Avatar for Superphosphate 64. Superphosphate Lv 1 2 pts. 9,640
  5. Avatar for rinze 65. rinze Lv 1 2 pts. 9,638
  6. Avatar for Museka 66. Museka Lv 1 2 pts. 9,634
  7. Avatar for tarimo 67. tarimo Lv 1 2 pts. 9,624
  8. Avatar for Savas 68. Savas Lv 1 1 pt. 9,622
  9. Avatar for Squirrely 69. Squirrely Lv 1 1 pt. 9,620
  10. Avatar for ManVsYard 70. ManVsYard Lv 1 1 pt. 9,596

Comments