Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups



  1. Avatar for andrewxc 81. andrewxc Lv 1 1 pt. 9,345
  2. Avatar for rabamino12358 82. rabamino12358 Lv 1 1 pt. 9,308
  3. Avatar for momadoc 83. momadoc Lv 1 1 pt. 9,302
  4. Avatar for PMiglionico 84. PMiglionico Lv 1 1 pt. 9,236
  5. Avatar for ourtown 85. ourtown Lv 1 1 pt. 9,209
  6. Avatar for martinf 86. martinf Lv 1 1 pt. 9,189
  7. Avatar for atlas100 87. atlas100 Lv 1 1 pt. 9,166
  8. Avatar for phi16 88. phi16 Lv 1 1 pt. 9,068
  9. Avatar for aneeta 89. aneeta Lv 1 1 pt. 9,042
  10. Avatar for N7mph 90. N7mph Lv 1 1 pt. 9,035

Comments