Placeholder image of a protein
Icon representing a puzzle

1551: Sketchbook Puzzle - Revisiting Puzzle 68: Bos Taurus

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
July 19, 2018
Expires
Max points
100
Description

This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. In this experimental puzzle you will have 128 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,627
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,513
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,502
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 10,395
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 10,294
  6. Avatar for Contenders 6. Contenders 7 pts. 10,196
  7. Avatar for HMT heritage 7. HMT heritage 4 pts. 10,145
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,970
  9. Avatar for freefolder 9. freefolder 1 pt. 9,823
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,762
  1. Avatar for Psych0Active 71. Psych0Active Lv 1 1 pt. 9,590
  2. Avatar for TastyMunchies 72. TastyMunchies Lv 1 1 pt. 9,586
  3. Avatar for toshiue 73. toshiue Lv 1 1 pt. 9,575
  4. Avatar for dbuske 74. dbuske Lv 1 1 pt. 9,572
  5. Avatar for DoctorSockrates 75. DoctorSockrates Lv 1 1 pt. 9,541
  6. Avatar for hexidecimalhack 76. hexidecimalhack Lv 1 1 pt. 9,490
  7. Avatar for Arne Heessels 77. Arne Heessels Lv 1 1 pt. 9,480
  8. Avatar for JasperD 78. JasperD Lv 1 1 pt. 9,448
  9. Avatar for fpc 79. fpc Lv 1 1 pt. 9,365
  10. Avatar for korinnac 80. korinnac Lv 1 1 pt. 9,348

Comments