Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for guineapig 41. guineapig Lv 1 16 pts. 9,902
  2. Avatar for MicElephant 42. MicElephant Lv 1 15 pts. 9,898
  3. Avatar for joremen 43. joremen Lv 1 14 pts. 9,872
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 13 pts. 9,863
  5. Avatar for isaksson 45. isaksson Lv 1 12 pts. 9,861
  6. Avatar for Flagg65a 46. Flagg65a Lv 1 12 pts. 9,856
  7. Avatar for veroxdraco 47. veroxdraco Lv 1 11 pts. 9,846
  8. Avatar for DoctorSockrates 48. DoctorSockrates Lv 1 10 pts. 9,845
  9. Avatar for andrewxc 49. andrewxc Lv 1 10 pts. 9,814
  10. Avatar for weitzen 50. weitzen Lv 1 9 pts. 9,796

Comments