Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731

  1. Avatar for guineapig 41. guineapig Lv 1 16 pts. 9,902
  2. Avatar for MicElephant 42. MicElephant Lv 1 15 pts. 9,898
  3. Avatar for joremen 43. joremen Lv 1 14 pts. 9,872
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 13 pts. 9,863
  5. Avatar for isaksson 45. isaksson Lv 1 12 pts. 9,861
  6. Avatar for Flagg65a 46. Flagg65a Lv 1 12 pts. 9,856
  7. Avatar for veroxdraco 47. veroxdraco Lv 1 11 pts. 9,846
  8. Avatar for DoctorSockrates 48. DoctorSockrates Lv 1 10 pts. 9,845
  9. Avatar for andrewxc 49. andrewxc Lv 1 10 pts. 9,814
  10. Avatar for weitzen 50. weitzen Lv 1 9 pts. 9,796

Comments