Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 8,659
  2. Avatar for freefolder 12. freefolder 1 pt. 8,163
  3. Avatar for UNTHSC_6201_2018 13. UNTHSC_6201_2018 1 pt. 7,649
  4. Avatar for test_group1 14. test_group1 1 pt. 4,879
  1. Avatar for manu8170 61. manu8170 Lv 1 5 pts. 9,586
  2. Avatar for alwen 62. alwen Lv 1 4 pts. 9,575
  3. Avatar for 181818 63. 181818 Lv 1 4 pts. 9,542
  4. Avatar for pfirth 64. pfirth Lv 1 4 pts. 9,537
  5. Avatar for mitarcher 65. mitarcher Lv 1 4 pts. 9,526
  6. Avatar for KingLear 66. KingLear Lv 1 3 pts. 9,525
  7. Avatar for silent gene 67. silent gene Lv 1 3 pts. 9,520
  8. Avatar for Vincera 68. Vincera Lv 1 3 pts. 9,502
  9. Avatar for alcor29 69. alcor29 Lv 1 3 pts. 9,476
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 2 pts. 9,464

Comments