Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731

  1. Avatar for manu8170 61. manu8170 Lv 1 5 pts. 9,586
  2. Avatar for alwen 62. alwen Lv 1 4 pts. 9,575
  3. Avatar for 181818 63. 181818 Lv 1 4 pts. 9,542
  4. Avatar for pfirth 64. pfirth Lv 1 4 pts. 9,537
  5. Avatar for mitarcher 65. mitarcher Lv 1 4 pts. 9,526
  6. Avatar for KingLear 66. KingLear Lv 1 3 pts. 9,525
  7. Avatar for silent gene 67. silent gene Lv 1 3 pts. 9,520
  8. Avatar for Vincera 68. Vincera Lv 1 3 pts. 9,502
  9. Avatar for alcor29 69. alcor29 Lv 1 3 pts. 9,476
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 2 pts. 9,464

Comments