Placeholder image of a protein
Icon representing a puzzle

1556: Revisiting Puzzle 73: Polycystein

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 01, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,618
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,474
  3. Avatar for Go Science 3. Go Science 44 pts. 10,455
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 10,447
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,439
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,400
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 10,322
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,189
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,731

  1. Avatar for ComputerMage 101. ComputerMage Lv 1 1 pt. 8,659
  2. Avatar for lamoille 102. lamoille Lv 1 1 pt. 8,649
  3. Avatar for antibot215 103. antibot215 Lv 1 1 pt. 8,637
  4. Avatar for momadoc 104. momadoc Lv 1 1 pt. 8,611
  5. Avatar for martinf 105. martinf Lv 1 1 pt. 8,601
  6. Avatar for leehaggis 106. leehaggis Lv 1 1 pt. 8,492
  7. Avatar for AtOneMent 107. AtOneMent Lv 1 1 pt. 8,490
  8. Avatar for plasterosporanny 108. plasterosporanny Lv 1 1 pt. 8,374
  9. Avatar for Rastamasta 109. Rastamasta Lv 1 1 pt. 8,344
  10. Avatar for Tehnologik1 110. Tehnologik1 Lv 1 1 pt. 8,278

Comments