Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Team Schleswig-Holstein 11. Team Schleswig-Holstein 1 pt. 172
  2. Avatar for test_group1 12. test_group1 1 pt. 0
  1. Avatar for Psych0Active 91. Psych0Active Lv 1 1 pt. 9,918
  2. Avatar for Gahmeir 92. Gahmeir Lv 1 1 pt. 9,817
  3. Avatar for mitarcher 93. mitarcher Lv 1 1 pt. 9,765
  4. Avatar for cobaltteal 94. cobaltteal Lv 1 1 pt. 9,755
  5. Avatar for plasterosporanny 95. plasterosporanny Lv 1 1 pt. 9,749
  6. Avatar for rinze 96. rinze Lv 1 1 pt. 9,576
  7. Avatar for toshiue 97. toshiue Lv 1 1 pt. 9,541
  8. Avatar for ViJay7019 98. ViJay7019 Lv 1 1 pt. 9,453
  9. Avatar for Might-o-chondria 99. Might-o-chondria Lv 1 1 pt. 9,435
  10. Avatar for pfeiffelfloyd 100. pfeiffelfloyd Lv 1 1 pt. 9,256

Comments