Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,503
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 11,445
  3. Avatar for Galaxie 3. Galaxie Lv 1 93 pts. 11,427
  4. Avatar for grogar7 4. grogar7 Lv 1 89 pts. 11,410
  5. Avatar for crpainter 5. crpainter Lv 1 86 pts. 11,392
  6. Avatar for bertro 6. bertro Lv 1 82 pts. 11,382
  7. Avatar for drjr 7. drjr Lv 1 79 pts. 11,381
  8. Avatar for tyler0911 8. tyler0911 Lv 1 76 pts. 11,372
  9. Avatar for phi16 9. phi16 Lv 1 73 pts. 11,368
  10. Avatar for actiasluna 10. actiasluna Lv 1 70 pts. 11,366

Comments