Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Team Schleswig-Holstein 11. Team Schleswig-Holstein 1 pt. 172
  2. Avatar for test_group1 12. test_group1 1 pt. 0
  1. Avatar for veroxdraco 111. veroxdraco Lv 1 1 pt. 6,145
  2. Avatar for larry25427 112. larry25427 Lv 1 1 pt. 5,895
  3. Avatar for The Apothecary 113. The Apothecary Lv 1 1 pt. 5,534
  4. Avatar for tayco123 114. tayco123 Lv 1 1 pt. 5,445
  5. Avatar for BlueKim 115. BlueKim Lv 1 1 pt. 5,281
  6. Avatar for Sci1217 116. Sci1217 Lv 1 1 pt. 5,252
  7. Avatar for Stewart J. Breier 117. Stewart J. Breier Lv 1 1 pt. 3,938
  8. Avatar for Ethrandir 118. Ethrandir Lv 1 1 pt. 3,293
  9. Avatar for kokifuku 119. kokifuku Lv 1 1 pt. 2,333
  10. Avatar for 01010011111 120. 01010011111 Lv 1 1 pt. 2,120

Comments