Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups



  1. Avatar for tarimo 41. tarimo Lv 1 16 pts. 11,083
  2. Avatar for Jesse Pinkman 42. Jesse Pinkman Lv 1 15 pts. 11,075
  3. Avatar for Altercomp 43. Altercomp Lv 1 14 pts. 11,069
  4. Avatar for heather-1 44. heather-1 Lv 1 13 pts. 11,050
  5. Avatar for ManVsYard 45. ManVsYard Lv 1 13 pts. 11,041
  6. Avatar for Mike Cassidy 46. Mike Cassidy Lv 1 12 pts. 11,022
  7. Avatar for Merf 47. Merf Lv 1 11 pts. 11,016
  8. Avatar for guineapig 48. guineapig Lv 1 11 pts. 11,005
  9. Avatar for MicElephant 49. MicElephant Lv 1 10 pts. 10,992
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 9 pts. 10,986

Comments