Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups



  1. Avatar for joremen 51. joremen Lv 1 9 pts. 10,946
  2. Avatar for sciencewalker 52. sciencewalker Lv 1 8 pts. 10,941
  3. Avatar for GetOffMyLawn 53. GetOffMyLawn Lv 1 8 pts. 10,926
  4. Avatar for katling 54. katling Lv 1 7 pts. 10,922
  5. Avatar for Susume 55. Susume Lv 1 7 pts. 10,921
  6. Avatar for stomjoh 56. stomjoh Lv 1 7 pts. 10,902
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 6 pts. 10,890
  8. Avatar for badgoes 58. badgoes Lv 1 6 pts. 10,876
  9. Avatar for drumpeter18yrs9yrs 59. drumpeter18yrs9yrs Lv 1 5 pts. 10,872
  10. Avatar for Deleted player 60. Deleted player pts. 10,871

Comments