Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Team Schleswig-Holstein 11. Team Schleswig-Holstein 1 pt. 172
  2. Avatar for test_group1 12. test_group1 1 pt. 0
  1. Avatar for momadoc 81. momadoc Lv 1 1 pt. 10,293
  2. Avatar for Ricardo Oliveira 82. Ricardo Oliveira Lv 1 1 pt. 10,290
  3. Avatar for alcor29 83. alcor29 Lv 1 1 pt. 10,272
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 1 pt. 10,250
  5. Avatar for Rastamasta 85. Rastamasta Lv 1 1 pt. 10,229
  6. Avatar for Arne Heessels 86. Arne Heessels Lv 1 1 pt. 10,128
  7. Avatar for andrewxc 87. andrewxc Lv 1 1 pt. 10,118
  8. Avatar for boondog 88. boondog Lv 1 1 pt. 10,054
  9. Avatar for Flagg65a 89. Flagg65a Lv 1 1 pt. 10,040
  10. Avatar for spb00000 90. spb00000 Lv 1 1 pt. 10,015

Comments