Placeholder image of a protein
Icon representing a puzzle

1558: Unsolved De-novo Freestyle 137

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KEELKKWQKDIRDRLKEMLDRDLKKLDEMRKKGASTEDLRDMEDKIEKKLKKILEELLKWLKSLDDDRDRELIDKLLKELKKQIEDLLEKILKYLRDILRKQS

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,503
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,427
  3. Avatar for Contenders 3. Contenders 37 pts. 11,392
  4. Avatar for Gargleblasters 4. Gargleblasters 21 pts. 11,366
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 11,350
  6. Avatar for Void Crushers 6. Void Crushers 5 pts. 11,318
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 11,305
  8. Avatar for Go Science 8. Go Science 1 pt. 11,247
  9. Avatar for freefolder 9. freefolder 1 pt. 11,069
  10. Avatar for Stuyvesant Molecular Science 2017-18 10. Stuyvesant Molecular Science 2017-18 1 pt. 9,435
  1. Avatar for dbuske 11. dbuske Lv 1 4 pts. 11,343
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 3 pts. 11,340
  3. Avatar for ManVsYard 13. ManVsYard Lv 1 2 pts. 11,327
  4. Avatar for JMStiffler 14. JMStiffler Lv 1 1 pt. 11,299
  5. Avatar for Blipperman 15. Blipperman Lv 1 1 pt. 11,204
  6. Avatar for toshiue 16. toshiue Lv 1 1 pt. 11,203
  7. Avatar for georg137 17. georg137 Lv 1 1 pt. 11,184
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 1 pt. 11,181
  9. Avatar for isaksson 19. isaksson Lv 1 1 pt. 11,147
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 1 pt. 11,131

Comments