Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,351
  2. Avatar for Stuyvesant Molecular Science 2017-18 12. Stuyvesant Molecular Science 2017-18 1 pt. 8,060
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 5,878
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 66 pts. 9,617
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 64 pts. 9,613
  3. Avatar for Glen B 13. Glen B Lv 1 61 pts. 9,612
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 58 pts. 9,611
  5. Avatar for crpainter 15. crpainter Lv 1 56 pts. 9,599
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 53 pts. 9,588
  7. Avatar for tyler0911 17. tyler0911 Lv 1 51 pts. 9,581
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 49 pts. 9,561
  9. Avatar for katling 19. katling Lv 1 46 pts. 9,552
  10. Avatar for jobo0502 20. jobo0502 Lv 1 44 pts. 9,520

Comments