Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Contenders 100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 66 pts. 9,617
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 64 pts. 9,613
  3. Avatar for Glen B 13. Glen B Lv 1 61 pts. 9,612
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 58 pts. 9,611
  5. Avatar for crpainter 15. crpainter Lv 1 56 pts. 9,599
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 53 pts. 9,588
  7. Avatar for tyler0911 17. tyler0911 Lv 1 51 pts. 9,581
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 49 pts. 9,561
  9. Avatar for katling 19. katling Lv 1 46 pts. 9,552
  10. Avatar for jobo0502 20. jobo0502 Lv 1 44 pts. 9,520

Comments