Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for phi16 31. phi16 Lv 1 26 pts. 9,444
  2. Avatar for guineapig 32. guineapig Lv 1 25 pts. 9,434
  3. Avatar for diamonddays 33. diamonddays Lv 1 23 pts. 9,408
  4. Avatar for MicElephant 34. MicElephant Lv 1 22 pts. 9,368
  5. Avatar for Crossed Sticks 35. Crossed Sticks Lv 1 21 pts. 9,368
  6. Avatar for Vinara 36. Vinara Lv 1 20 pts. 9,360
  7. Avatar for Blipperman 37. Blipperman Lv 1 19 pts. 9,318
  8. Avatar for YeshuaLives 38. YeshuaLives Lv 1 18 pts. 9,312
  9. Avatar for joremen 39. joremen Lv 1 17 pts. 9,290
  10. Avatar for stomjoh 40. stomjoh Lv 1 16 pts. 9,288

Comments