1559: Revisiting Puzzle 74: Platypus Venom
Closed since over 7 years ago
Intermediate Overall PredictionSummary
- Created
- August 06, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK