Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups



  1. Avatar for rezaefar 71. rezaefar Lv 1 2 pts. 8,585
  2. Avatar for ViJay7019 72. ViJay7019 Lv 1 2 pts. 8,571
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 2 pts. 8,521
  4. Avatar for 181818 74. 181818 Lv 1 2 pts. 8,518
  5. Avatar for Altercomp 75. Altercomp Lv 1 2 pts. 8,406
  6. Avatar for metafolder 76. metafolder Lv 1 2 pts. 8,403
  7. Avatar for jebbiek 77. jebbiek Lv 1 1 pt. 8,402
  8. Avatar for ppp6 78. ppp6 Lv 1 1 pt. 8,398
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 1 pt. 8,381
  10. Avatar for joaniegirl 80. joaniegirl Lv 1 1 pt. 8,377

Comments