Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Contenders 100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406

  1. Avatar for rezaefar 71. rezaefar Lv 1 2 pts. 8,585
  2. Avatar for ViJay7019 72. ViJay7019 Lv 1 2 pts. 8,571
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 2 pts. 8,521
  4. Avatar for 181818 74. 181818 Lv 1 2 pts. 8,518
  5. Avatar for Altercomp 75. Altercomp Lv 1 2 pts. 8,406
  6. Avatar for metafolder 76. metafolder Lv 1 2 pts. 8,403
  7. Avatar for jebbiek 77. jebbiek Lv 1 1 pt. 8,402
  8. Avatar for ppp6 78. ppp6 Lv 1 1 pt. 8,398
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 1 pt. 8,381
  10. Avatar for joaniegirl 80. joaniegirl Lv 1 1 pt. 8,377

Comments