Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406
  1. Avatar for uihcv 121. uihcv Lv 1 1 pt. 5,878
  2. Avatar for kokifuku 122. kokifuku Lv 1 1 pt. 5,878
  3. Avatar for meatexplosion 123. meatexplosion Lv 1 1 pt. 5,878
  4. Avatar for spb00000 124. spb00000 Lv 1 1 pt. 5,878
  5. Avatar for Hollinas 125. Hollinas Lv 1 1 pt. 5,878
  6. Avatar for izzgood 126. izzgood Lv 1 1 pt. 5,878

Comments