Placeholder image of a protein
Icon representing a puzzle

1559: Revisiting Puzzle 74: Platypus Venom

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 06, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom—a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,992
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 9,702
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 9,681
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,667
  6. Avatar for HMT heritage 6. HMT heritage 7 pts. 9,643
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,617
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 9,611
  9. Avatar for Go Science 9. Go Science 1 pt. 9,588
  10. Avatar for freefolder 10. freefolder 1 pt. 8,406
  1. Avatar for larry25427 101. larry25427 Lv 1 1 pt. 8,047
  2. Avatar for 01010011111 102. 01010011111 Lv 1 1 pt. 8,008
  3. Avatar for Anamfija 103. Anamfija Lv 1 1 pt. 7,993
  4. Avatar for Alistair69 104. Alistair69 Lv 1 1 pt. 7,991
  5. Avatar for Singam 105. Singam Lv 1 1 pt. 7,990
  6. Avatar for Lendsheep 106. Lendsheep Lv 1 1 pt. 7,932
  7. Avatar for xabxs 107. xabxs Lv 1 1 pt. 7,915
  8. Avatar for momadoc 108. momadoc Lv 1 1 pt. 7,907
  9. Avatar for jbmkfm125 109. jbmkfm125 Lv 1 1 pt. 7,809
  10. Avatar for frostschutz 110. frostschutz Lv 1 1 pt. 7,805

Comments