Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for matosfran
    1. matosfran Lv 1
    100 pts. 10,182
  2. Avatar for crpainter 2. crpainter Lv 1 97 pts. 10,153
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,143
  4. Avatar for georg137 4. georg137 Lv 1 90 pts. 10,139
  5. Avatar for reefyrob 5. reefyrob Lv 1 86 pts. 10,135
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 83 pts. 10,128
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 80 pts. 10,119
  8. Avatar for Aubade01 8. Aubade01 Lv 1 77 pts. 10,111
  9. Avatar for joremen 9. joremen Lv 1 74 pts. 10,111
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 71 pts. 10,105

Comments