1562: Revisiting Puzzle 75: Antifreeze Protein
Closed since over 7 years ago
Intermediate Overall PredictionSummary
- Created
- August 14, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA