Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,633
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,606
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,583
  4. Avatar for freefolder 14. freefolder 1 pt. 9,522
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,296
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 9,195
  1. Avatar for matosfran
    1. matosfran Lv 1
    100 pts. 10,182
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 78 pts. 10,143
  3. Avatar for toshiue 3. toshiue Lv 1 60 pts. 10,143
  4. Avatar for LociOiling 4. LociOiling Lv 1 45 pts. 10,138
  5. Avatar for actiasluna 5. actiasluna Lv 1 33 pts. 10,137
  6. Avatar for ManVsYard 6. ManVsYard Lv 1 24 pts. 10,123
  7. Avatar for Blipperman 7. Blipperman Lv 1 17 pts. 10,123
  8. Avatar for Galaxie 8. Galaxie Lv 1 12 pts. 10,092
  9. Avatar for robgee 9. robgee Lv 1 8 pts. 10,082
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 6 pts. 10,080

Comments