Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740
  1. Avatar for alwen 11. alwen Lv 1 4 pts. 10,078
  2. Avatar for alcor29 12. alcor29 Lv 1 2 pts. 10,078
  3. Avatar for lamoille 13. lamoille Lv 1 2 pts. 10,077
  4. Avatar for dbuske 14. dbuske Lv 1 1 pt. 10,061
  5. Avatar for smilingone 15. smilingone Lv 1 1 pt. 10,060
  6. Avatar for JMStiffler 16. JMStiffler Lv 1 1 pt. 10,049
  7. Avatar for reefyrob 17. reefyrob Lv 1 1 pt. 10,042
  8. Avatar for Hollinas 18. Hollinas Lv 1 1 pt. 10,023
  9. Avatar for isaksson 19. isaksson Lv 1 1 pt. 9,950
  10. Avatar for ViJay7019 20. ViJay7019 Lv 1 1 pt. 9,929

Comments