Placeholder image of a protein
Icon representing a puzzle

1562: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,182
  2. Avatar for Contenders 2. Contenders 71 pts. 10,153
  3. Avatar for Go Science 3. Go Science 49 pts. 10,143
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,137
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,102
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 10,099
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 10,066
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,059
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,044
  10. Avatar for Team China 10. Team China 2 pts. 9,740

  1. Avatar for dbuske 51. dbuske Lv 1 10 pts. 9,900
  2. Avatar for YeshuaLives 52. YeshuaLives Lv 1 10 pts. 9,892
  3. Avatar for MicElephant 53. MicElephant Lv 1 9 pts. 9,891
  4. Avatar for justjustin 54. justjustin Lv 1 9 pts. 9,888
  5. Avatar for Vinara 55. Vinara Lv 1 8 pts. 9,860
  6. Avatar for KingLear 56. KingLear Lv 1 8 pts. 9,858
  7. Avatar for rezaefar 57. rezaefar Lv 1 7 pts. 9,857
  8. Avatar for altejoh 58. altejoh Lv 1 7 pts. 9,853
  9. Avatar for tarimo 59. tarimo Lv 1 6 pts. 9,849
  10. Avatar for manu8170 60. manu8170 Lv 1 6 pts. 9,831

Comments