Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for leehaggis 101. leehaggis Lv 1 1 pt. 8,899
  2. Avatar for KimJongUn 102. KimJongUn Lv 1 1 pt. 8,815
  3. Avatar for gurch 103. gurch Lv 1 1 pt. 8,814
  4. Avatar for brooney6366 104. brooney6366 Lv 1 1 pt. 8,804
  5. Avatar for lamoille 105. lamoille Lv 1 1 pt. 8,792
  6. Avatar for joaniegirl 106. joaniegirl Lv 1 1 pt. 8,779
  7. Avatar for Alpha-Cessy 107. Alpha-Cessy Lv 1 1 pt. 8,745
  8. Avatar for aspadistra 108. aspadistra Lv 1 1 pt. 8,682
  9. Avatar for iON_Q 109. iON_Q Lv 1 1 pt. 8,673
  10. Avatar for Sydefecks 110. Sydefecks Lv 1 1 pt. 8,665

Comments