Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for nicobul 11. nicobul Lv 1 67 pts. 10,100
  2. Avatar for Aubade01 12. Aubade01 Lv 1 65 pts. 10,098
  3. Avatar for reefyrob 13. reefyrob Lv 1 62 pts. 10,089
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 59 pts. 10,057
  5. Avatar for pauldunn 15. pauldunn Lv 1 57 pts. 10,038
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 54 pts. 10,007
  7. Avatar for pvc78 17. pvc78 Lv 1 52 pts. 9,983
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 50 pts. 9,977
  9. Avatar for isaksson 19. isaksson Lv 1 48 pts. 9,968
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 46 pts. 9,939

Comments