Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 44 pts. 9,933
  2. Avatar for phi16 22. phi16 Lv 1 42 pts. 9,932
  3. Avatar for O Seki To 23. O Seki To Lv 1 40 pts. 9,930
  4. Avatar for justjustin 24. justjustin Lv 1 38 pts. 9,922
  5. Avatar for drjr 25. drjr Lv 1 36 pts. 9,880
  6. Avatar for Museka 26. Museka Lv 1 35 pts. 9,849
  7. Avatar for joremen 27. joremen Lv 1 33 pts. 9,845
  8. Avatar for stomjoh 28. stomjoh Lv 1 31 pts. 9,821
  9. Avatar for YeshuaLives 29. YeshuaLives Lv 1 30 pts. 9,808
  10. Avatar for Vinara 30. Vinara Lv 1 28 pts. 9,806

Comments