Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 27 pts. 9,794
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 26 pts. 9,782
  3. Avatar for gdnskye 33. gdnskye Lv 1 25 pts. 9,769
  4. Avatar for katling 34. katling Lv 1 23 pts. 9,768
  5. Avatar for tyler0911 35. tyler0911 Lv 1 22 pts. 9,762
  6. Avatar for georg137 36. georg137 Lv 1 21 pts. 9,743
  7. Avatar for Norrjane 37. Norrjane Lv 1 20 pts. 9,734
  8. Avatar for altejoh 38. altejoh Lv 1 19 pts. 9,727
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 18 pts. 9,720
  10. Avatar for diamonddays 40. diamonddays Lv 1 17 pts. 9,712

Comments