Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 16 pts. 9,711
  2. Avatar for robgee 42. robgee Lv 1 15 pts. 9,706
  3. Avatar for tarimo 43. tarimo Lv 1 14 pts. 9,695
  4. Avatar for guineapig 44. guineapig Lv 1 14 pts. 9,692
  5. Avatar for cbwest 45. cbwest Lv 1 13 pts. 9,684
  6. Avatar for ourtown 46. ourtown Lv 1 12 pts. 9,679
  7. Avatar for Deleted player 47. Deleted player pts. 9,671
  8. Avatar for fpc 48. fpc Lv 1 11 pts. 9,664
  9. Avatar for sciencewalker 49. sciencewalker Lv 1 10 pts. 9,658
  10. Avatar for pfirth 50. pfirth Lv 1 10 pts. 9,653

Comments