Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321
  1. Avatar for johnmitch 51. johnmitch Lv 1 9 pts. 9,651
  2. Avatar for Blipperman 52. Blipperman Lv 1 9 pts. 9,630
  3. Avatar for Hiro Protagonist 53. Hiro Protagonist Lv 1 8 pts. 9,603
  4. Avatar for SWR_DMaster 54. SWR_DMaster Lv 1 8 pts. 9,584
  5. Avatar for orily1337 55. orily1337 Lv 1 7 pts. 9,577
  6. Avatar for GetOffMyLawn 56. GetOffMyLawn Lv 1 7 pts. 9,573
  7. Avatar for Merf 57. Merf Lv 1 6 pts. 9,570
  8. Avatar for multaq 58. multaq Lv 1 6 pts. 9,565
  9. Avatar for MicElephant 59. MicElephant Lv 1 6 pts. 9,548
  10. Avatar for hansvandenhof 60. hansvandenhof Lv 1 5 pts. 9,539

Comments