Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321

  1. Avatar for ReallyRatherDumb 61. ReallyRatherDumb Lv 1 5 pts. 9,525
  2. Avatar for Crossed Sticks 62. Crossed Sticks Lv 1 5 pts. 9,516
  3. Avatar for manu8170 63. manu8170 Lv 1 4 pts. 9,513
  4. Avatar for jobo0502 64. jobo0502 Lv 1 4 pts. 9,504
  5. Avatar for izzgood 65. izzgood Lv 1 4 pts. 9,495
  6. Avatar for khalan.ysatis 66. khalan.ysatis Lv 1 4 pts. 9,483
  7. Avatar for Alistair69 67. Alistair69 Lv 1 3 pts. 9,459
  8. Avatar for alcor29 68. alcor29 Lv 1 3 pts. 9,452
  9. Avatar for Jesse Pinkman 69. Jesse Pinkman Lv 1 3 pts. 9,450
  10. Avatar for Glen B 70. Glen B Lv 1 3 pts. 9,436

Comments