Placeholder image of a protein
Icon representing a puzzle

1568: Revisiting Puzzle 77: Copper Chaperone

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
August 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,495
  2. Avatar for freefolder 12. freefolder 1 pt. 9,063
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,682
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,659
  5. Avatar for Team South Africa 15. Team South Africa 1 pt. 8,321

  1. Avatar for frostschutz 71. frostschutz Lv 1 3 pts. 9,425
  2. Avatar for weitzen 72. weitzen Lv 1 2 pts. 9,410
  3. Avatar for ManVsYard 73. ManVsYard Lv 1 2 pts. 9,407
  4. Avatar for toshiue 74. toshiue Lv 1 2 pts. 9,399
  5. Avatar for silent gene 75. silent gene Lv 1 2 pts. 9,372
  6. Avatar for Vincera 76. Vincera Lv 1 2 pts. 9,366
  7. Avatar for alwen 77. alwen Lv 1 2 pts. 9,363
  8. Avatar for Jajaboman 78. Jajaboman Lv 1 2 pts. 9,358
  9. Avatar for rabamino12358 79. rabamino12358 Lv 1 1 pt. 9,356
  10. Avatar for kludbrook 80. kludbrook Lv 1 1 pt. 9,272

Comments